GOLPH3 Polyclonal AntibodyGOLPH3 Polyclonal Antibody
Move your mouse over image or click to enlarge

GOLPH3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13121-200ul 200ul
£332.50
A13121-100ul 100ul
£192.50
A13121-50ul 50ul
£113.75
A13121-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13121
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GOLPH3; GOPP1; GPP34; MIDAS; Vps74; Golgi phosphoprotein 3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-298 of human GOLPH3 (NP_071413.1).
Reactivity Human, Mouse, Rat
Gene ID 64083
Calculated MW 33kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents