GNPDA1 Polyclonal AntibodyGNPDA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

GNPDA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13717-200ul 200ul
£332.50
A13717-100ul 100ul
£192.50
A13717-50ul 50ul
£113.75
A13717-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13717
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GNPDA1; GNP1; GNPDA; GNPI; GPI; HLN; glucosamine-6-phosphate isomerase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human GNPDA1 (NP_005462.1).
Reactivity Human, Mouse, Rat
Gene ID 10007
Calculated MW 24kDa/32kDa
Observed MW 30-33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents