GNGT2 Polyclonal AntibodyGNGT2 Polyclonal Antibody
Move your mouse over image or click to enlarge

GNGT2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13992-200ul 200ul
£332.50
A13992-100ul 100ul
£192.50
A13992-50ul 50ul
£113.75
A13992-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13992
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GNGT2; G-GAMMA-8; G-GAMMA-C; GNG8; GNG9; GNGT8; G protein subunit gamma transducin 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human GNGT2 (NP_113686.1).
Reactivity Human, Mouse
Gene ID 2793
Calculated MW 7kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents