GNB5 Polyclonal AntibodyGNB5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GNB5 Polyclonal Antibody

Cat# Size Price Qty Buy
A4447-200ul 200ul
£332.50
A4447-100ul 100ul
£192.50
A4447-50ul 50ul
£113.75
A4447-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4447
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GNB5; GB5; IDDCA; LADCI; G protein subunit beta 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GNB5 (NP_006569.1).
Reactivity Human, Mouse, Rat
Gene ID 10681
Calculated MW 31kDa/38kDa/43kDa
Observed MW 39kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents