GNAT3 Polyclonal AntibodyGNAT3 Polyclonal Antibody
Move your mouse over image or click to enlarge

GNAT3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15982-20ul 20ul
£77.00
A15982-50ul 50ul
£113.75
A15982-100ul 100ul
£192.50
A15982-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15982
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GNAT3; GDCA; G protein subunit alpha transducin 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human GNAT3 (NP_001095856.1).
Reactivity Human
Gene ID 346562
Calculated MW 40kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GYSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents