GLYAT Polyclonal AntibodyGLYAT Polyclonal Antibody
Move your mouse over image or click to enlarge

GLYAT Polyclonal Antibody

Cat# Size Price Qty Buy
A13831-200ul 200ul
£332.50
A13831-100ul 100ul
£192.50
A13831-50ul 50ul
£113.75
A13831-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13831
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GLYAT; ACGNAT; CAT; GAT; glycine N-acyltransferase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human GLYAT (NP_005829.3).
Reactivity Human
Gene ID 10249
Calculated MW 18kDa/33kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPNGGKPKAM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents