GLP1R Polyclonal AntibodyGLP1R Polyclonal Antibody
Move your mouse over image or click to enlarge

GLP1R Polyclonal Antibody

Cat# Size Price Qty Buy
A13990-200ul 200ul
£332.50
A13990-100ul 100ul
£192.50
A13990-50ul 50ul
£113.75
A13990-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13990
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GLP1R; GLP-1; GLP-1-R; GLP-1R; glucagon-like peptide 1 receptor
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3).
Reactivity Human, Rat
Gene ID 2740
Calculated MW 53kDa
Observed MW 53kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents