GLCCI1 Polyclonal AntibodyGLCCI1 Polyclonal Antibody
Move your mouse over image or click to enlarge

GLCCI1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15934-20ul 20ul
£77.00
A15934-50ul 50ul
£113.75
A15934-100ul 100ul
£192.50
A15934-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15934
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GLCCI1; FAM117C; GCTR; GIG18; TSSN1; glucocorticoid induced 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-230 of human GLCCI1 (NP_612435.1).
Reactivity Human, Mouse
Gene ID 113263
Calculated MW 58kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QAPRAKGRPRRSPESHRRSSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents