GJA5 Polyclonal AntibodyGJA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GJA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13494-200ul 200ul
£332.50
A13494-100ul 100ul
£192.50
A13494-50ul 50ul
£113.75
A13494-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13494
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GJA5; ATFB11; CX40; gap junction alpha-5 protein
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1).
Reactivity Human
Gene ID 2702
Calculated MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents