GGT5 Polyclonal AntibodyGGT5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GGT5 Polyclonal Antibody

Cat# Size Price Qty Buy
A14374-200ul 200ul
£332.50
A14374-100ul 100ul
£192.50
A14374-50ul 50ul
£113.75
A14374-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14374
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GGT5; GGL; GGT 5; GGT-REL; GGTLA1; gamma-glutamyltransferase 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human GGT5 (NP_001093251.1).
Reactivity Human, Mouse
Gene ID 2687
Calculated MW 58kDa/62kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPAVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents