GDF5 Polyclonal AntibodyGDF5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GDF5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13167-200ul 200ul
£332.50
A13167-100ul 100ul
£192.50
A13167-50ul 50ul
£113.75
A13167-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13167
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GDF5; BDA1C; BMP-14; BMP14; CDMP1; LAP-4; LAP4; OS5; SYM1B; SYNS2; growth/differentiation factor 5
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GDF5 (NP_000548.2).
Reactivity Mouse, Rat
Gene ID 8200
Calculated MW 55kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KRDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents