GATA4 Polyclonal AntibodyGATA4 Polyclonal Antibody
Move your mouse over image or click to enlarge

GATA4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13756-200ul 200ul
£332.50
A13756-100ul 100ul
£192.50
A13756-50ul 50ul
£113.75
A13756-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13756
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GATA4; ASD2; TACHD; TOF; VSD1; GATA binding protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GATA4 (NP_002043.2).
Reactivity Mouse
Gene ID 2626
Calculated MW 44kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GLSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents