GALM Polyclonal AntibodyGALM Polyclonal Antibody
Move your mouse over image or click to enlarge

GALM Polyclonal Antibody

Cat# Size Price Qty Buy
A14362-200ul 200ul
£332.50
A14362-100ul 100ul
£192.50
A14362-50ul 50ul
£113.75
A14362-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14362
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GALM; BLOCK25; GLAT; HEL-S-63p; IBD1; aldose 1-epimerase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human GALM (NP_620156.1).
Reactivity Human, Mouse, Rat
Gene ID 130589
Calculated MW 37kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents