GADD45A Polyclonal AntibodyGADD45A Polyclonal Antibody
Move your mouse over image or click to enlarge

GADD45A Polyclonal Antibody

Cat# Size Price Qty Buy
A13487-200ul 200ul
£332.50
A13487-100ul 100ul
£192.50
A13487-50ul 50ul
£113.75
A13487-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13487
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GADD45A; DDIT1; GADD45; growth arrest and DNA damage inducible alpha
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1).
Reactivity Human, Mouse
Gene ID 1647
Calculated MW 14kDa/18kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents