GABRE Polyclonal AntibodyGABRE Polyclonal Antibody
Move your mouse over image or click to enlarge

GABRE Polyclonal Antibody

Cat# Size Price Qty Buy
A14239-200ul 200ul
£332.50
A14239-100ul 100ul
£192.50
A14239-50ul 50ul
£113.75
A14239-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14239
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GABRE; gamma-aminobutyric acid receptor subunit epsilon
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-253 of human GABRE (NP_004952.2).
Reactivity Human
Gene ID 2564
Calculated MW 41kDa/57kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents