GABRD Polyclonal AntibodyGABRD Polyclonal Antibody
Move your mouse over image or click to enlarge

GABRD Polyclonal Antibody

Cat# Size Price Qty Buy
A16016-20ul 20ul
£77.00
A16016-50ul 50ul
£113.75
A16016-100ul 100ul
£192.50
A16016-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16016
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GABRD; EIG10; EJM7; GEFSP5; gamma-aminobutyric acid receptor subunit delta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-430 of human GABRD (NP_000806.2).
Reactivity Human, Mouse, Rat
Gene ID 2563
Calculated MW 50kDa
Observed MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FAHFNADYRKKQKAKVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARLRPIDADTIDIY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents