GABRA5 Polyclonal AntibodyGABRA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GABRA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13984-200ul 200ul
£332.50
A13984-100ul 100ul
£192.50
A13984-50ul 50ul
£113.75
A13984-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13984
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GABRA5; gamma-aminobutyric acid receptor subunit alpha-5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-259 of human GABRA5 (NP_000801.1).
Reactivity Human, Mouse, Rat
Gene ID 2558
Calculated MW 52kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents