GABARAP Polyclonal AntibodyGABARAP Polyclonal Antibody
Move your mouse over image or click to enlarge

GABARAP Polyclonal Antibody

Cat# Size Price Qty Buy
A13855-200ul 200ul
£332.50
A13855-100ul 100ul
£192.50
A13855-50ul 50ul
£113.75
A13855-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13855
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GABARAP; ATG8A; GABARAP-a; MM46; GABA type A receptor-associated protein
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1).
Reactivity Human, Mouse, Rat
Gene ID 11337
Calculated MW 13kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents