G0S2 Polyclonal AntibodyG0S2 Polyclonal Antibody
Move your mouse over image or click to enlarge

G0S2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14125-200ul 200ul
£332.50
A14125-100ul 100ul
£192.50
A14125-50ul 50ul
£113.75
A14125-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14125
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names G0S2; G0/G1 switch 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human G0S2 (NP_056529.1).
Reactivity Human
Gene ID 50486
Calculated MW 11kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents