FZD7 Polyclonal AntibodyFZD7 Polyclonal Antibody
Move your mouse over image or click to enlarge

FZD7 Polyclonal Antibody

Cat# Size Price Qty Buy
A4213-200ul 200ul
£332.50
A4213-100ul 100ul
£192.50
A4213-50ul 50ul
£113.75
A4213-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4213
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FZD7; FzE3; frizzled-7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human FZD7 (NP_003498.1).
Reactivity Human, Mouse
Gene ID 8324
Calculated MW 63kDa
Observed MW 70-72kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents