FYB Polyclonal AntibodyFYB Polyclonal Antibody
Move your mouse over image or click to enlarge

FYB Polyclonal Antibody

Cat# Size Price Qty Buy
A15997-50ul 50ul
£113.75
A15997-20ul 20ul
£77.00
A15997-200ul 200ul
£332.50
A15997-100ul 100ul
£192.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15997
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FYB; ADAP; PRO0823; SLAP-130; SLAP130; THC3; FYN-binding protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 678-829 of human FYB (NP_001456.3).
Reactivity Human
Gene ID 2533
Calculated MW 85kDa/90kDa/91kDa
Observed MW 130kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NEGSSFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIYDND
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents