FXR2 Polyclonal AntibodyFXR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

FXR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4313-200ul 200ul
£332.50
A4313-100ul 100ul
£192.50
A4313-50ul 50ul
£113.75
A4313-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4313
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FXR2; FMR1L2; FXR2P; FMR1 autosomal homolog 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2).
Reactivity Human, Mouse
Gene ID 9513
Calculated MW 74kDa
Observed MW 104kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents