FUT6 Polyclonal AntibodyFUT6 Polyclonal Antibody
Move your mouse over image or click to enlarge

FUT6 Polyclonal Antibody

Cat# Size Price Qty Buy
A3868-200ul 200ul
£332.50
A3868-100ul 100ul
£192.50
A3868-50ul 50ul
£113.75
A3868-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3868
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FUT6; FCT3A; FT1A; Fuc-TVI; FucT-VI; fucosyltransferase 6
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1).
Reactivity Human
Gene ID 2528
Calculated MW 41kDa/42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents