FRMD3 Polyclonal AntibodyFRMD3 Polyclonal Antibody
Move your mouse over image or click to enlarge

FRMD3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16025-20ul 20ul
£77.00
A16025-50ul 50ul
£113.75
A16025-100ul 100ul
£192.50
A16025-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16025
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FRMD3; 4.1O; EPB41L4O; EPB41LO; P410; FERM domain containing 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human FRMD3 (NP_777598.3).
Reactivity Human
Gene ID 257019
Calculated MW 23kDa/40kDa/63kDa/68kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence FRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents