FOXO1 Polyclonal AntibodyFOXO1 Polyclonal Antibody
Move your mouse over image or click to enlarge

FOXO1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13862-200ul 200ul
£332.50
A13862-100ul 100ul
£192.50
A13862-50ul 50ul
£113.75
A13862-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13862
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FOXO1; FKH1; FKHR; FOXO1A; forkhead box O1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-580 of human FOXO1 (NP_002006.2).
Reactivity Human, Mouse
Gene ID 2308
Calculated MW 69kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents