FNBP4 Polyclonal AntibodyFNBP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

FNBP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13804-200ul 200ul
£332.50
A13804-100ul 100ul
£192.50
A13804-50ul 50ul
£113.75
A13804-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13804
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FNBP4; FBP30; formin-binding protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human FNBP4 (NP_056123.2).
Reactivity Mouse
Gene ID 23360
Calculated MW 110kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGKKSRAVPGRRPILQLSPPGPRGSTPGRDPEPEPDTEPDSTAAVPSQPAPSAATTTTTAVTAAAASDDSPSEDEQEAVQEVPRVVQNPPKPVMTTRPTAVKATGGLCLLGAYADSDDDDNDVSEKLAQSKETNGNQSTDIDSTLANFLAEIDAITAPQPAAPVGASAPPPTPPRPEPKEAATSTLSSSTSNGTDSTQTSGWQYDTQCSLAGVGIEMGDWQEVWDENTGCYYYWNTQTNEVTWELPQYLATQVQGLQHYQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents