FLJ12529 Polyclonal AntibodyFLJ12529 Polyclonal Antibody
Move your mouse over image or click to enlarge

FLJ12529 Polyclonal Antibody

Cat# Size Price Qty Buy
A13880-200ul 200ul
£332.50
A13880-100ul 100ul
£192.50
A13880-50ul 50ul
£113.75
A13880-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13880
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CPSF7; CFIm59; cleavage and polyadenylation specific factor 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-240 of human FLJ12529 (NP_079087.3).
Reactivity Human, Mouse
Gene ID 79869
Calculated MW 51kDa/52kDa/56kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents