FKBP14 Polyclonal AntibodyFKBP14 Polyclonal Antibody
Move your mouse over image or click to enlarge

FKBP14 Polyclonal Antibody

Cat# Size Price Qty Buy
A13221-200ul 200ul
£332.50
A13221-100ul 100ul
£192.50
A13221-50ul 50ul
£113.75
A13221-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13221
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FKBP14; EDSKMH; FKBP22; IPBP12; FK506 binding protein 14
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-211 of human FKBP14 (NP_060416.1).
Reactivity Human, Mouse, Rat
Gene ID 55033
Calculated MW 24kDa
Observed MW 22kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents