FGB Polyclonal AntibodyFGB Polyclonal Antibody
Move your mouse over image or click to enlarge

FGB Polyclonal Antibody

Cat# Size Price Qty Buy
A1401-200ul 200ul
£332.50
A1401-100ul 100ul
£192.50
A1401-50ul 50ul
£113.75
A1401-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1401
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FGB; HEL-S-78p; fibrinogen beta chain
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-491 of human FGB (NP_005132.2).
Reactivity Human, Mouse, Rat
Gene ID 2244
Calculated MW 55kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents