FGA Polyclonal AntibodyFGA Polyclonal Antibody
Move your mouse over image or click to enlarge

FGA Polyclonal Antibody

Cat# Size Price Qty Buy
A1453-200ul 200ul
£332.50
A1453-100ul 100ul
£192.50
A1453-50ul 50ul
£113.75
A1453-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1453
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FGA; Fib2; fibrinogen alpha chain
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-339 of human FGA (NP_068657.1).
Reactivity Human, Mouse, Rat
Gene ID 2243
Calculated MW 69kDa/94kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence VERHQSACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSS
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents