FBXW2 Polyclonal AntibodyFBXW2 Polyclonal Antibody
Move your mouse over image or click to enlarge

FBXW2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15996-20ul 20ul
£77.00
A15996-50ul 50ul
£113.75
A15996-100ul 100ul
£192.50
A15996-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15996
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FBXW2; FBW2; Fwd2; Md6; F-box/WD repeat-containing protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human FBXW2 (NP_036296.2).
Reactivity Mouse, Rat
Gene ID 26190
Calculated MW 44kDa/51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents