FBXO33 Polyclonal AntibodyFBXO33 Polyclonal Antibody
Move your mouse over image or click to enlarge

FBXO33 Polyclonal Antibody

Cat# Size Price Qty Buy
A14303-200ul 200ul
£332.50
A14303-100ul 100ul
£192.50
A14303-50ul 50ul
£113.75
A14303-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14303
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FBXO33; BMND12; Fbx33; c14_5247; F-box protein 33
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 346-555 of human FBXO33 (NP_976046.1).
Reactivity Rat
Gene ID 254170
Calculated MW 62kDa
Observed MW 63kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VMHKSLDNMPNDEHWKALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSEDI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents