FBXO24 Polyclonal AntibodyFBXO24 Polyclonal Antibody
Move your mouse over image or click to enlarge

FBXO24 Polyclonal Antibody

Cat# Size Price Qty Buy
A13770-200ul 200ul
£332.50
A13770-100ul 100ul
£192.50
A13770-50ul 50ul
£113.75
A13770-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13770
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FBXO24; FBX24; F-box protein 24
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human FBXO24 (NP_277041.1).
Reactivity Human, Mouse
Gene ID 26261
Calculated MW 36kDa/63kDa/64kDa/69kDa
Observed MW 64kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents