FAM3B Polyclonal AntibodyFAM3B Polyclonal Antibody
Move your mouse over image or click to enlarge

FAM3B Polyclonal Antibody

Cat# Size Price Qty Buy
A14215-200ul 200ul
£332.50
A14215-100ul 100ul
£192.50
A14215-50ul 50ul
£113.75
A14215-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14215
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FAM3B; 2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44; protein FAM3B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human FAM3B (NP_478066.3).
Reactivity Mouse
Gene ID 54097
Calculated MW 20kDa/25kDa/30kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents