FAM117B Polyclonal AntibodyFAM117B Polyclonal Antibody
Move your mouse over image or click to enlarge

FAM117B Polyclonal Antibody

Cat# Size Price Qty Buy
A3551-200ul 200ul
£332.50
A3551-100ul 100ul
£192.50
A3551-50ul 50ul
£113.75
A3551-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3551
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FAM117B; ALS2CR13; protein FAM117B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2).
Reactivity Human, Mouse
Gene ID 150864
Calculated MW 29kDa/61kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents