FADS3 Polyclonal AntibodyFADS3 Polyclonal Antibody
Move your mouse over image or click to enlarge

FADS3 Polyclonal Antibody

Cat# Size Price Qty Buy
A3947-200ul 200ul
£332.50
A3947-100ul 100ul
£192.50
A3947-50ul 50ul
£113.75
A3947-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3947
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FADS3; CYB5RP; LLCDL3; fatty acid desaturase 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human FADS3 (NP_068373.1).
Reactivity Human, Mouse, Rat
Gene ID 3995
Calculated MW 51kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents