FABP6 Polyclonal AntibodyFABP6 Polyclonal Antibody
Move your mouse over image or click to enlarge

FABP6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13491-200ul 200ul
£332.50
A13491-100ul 100ul
£192.50
A13491-50ul 50ul
£113.75
A13491-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13491
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FABP6; I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ILLBP; gastrotropin
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human FABP6 (NP_001436.1).
Reactivity Human
Gene ID 2172
Calculated MW 14kDa/19kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents