FA2H Polyclonal AntibodyFA2H Polyclonal Antibody
Move your mouse over image or click to enlarge

FA2H Polyclonal Antibody

Cat# Size Price Qty Buy
A13874-200ul 200ul
£332.50
A13874-100ul 100ul
£192.50
A13874-50ul 50ul
£113.75
A13874-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13874
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FA2H; FAAH; FAH1; FAXDC1; SCS7; SPG35; fatty acid 2-hydroxylase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 95-170 of human FA2H (NP_077282.3).
Reactivity Mouse, Rat
Gene ID 79152
Calculated MW 18kDa/42kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents