EZH2 Polyclonal AntibodyEZH2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EZH2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13867-200ul 200ul
£332.50
A13867-100ul 100ul
£192.50
A13867-50ul 50ul
£113.75
A13867-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13867
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EZH2; ENX-1; ENX1; EZH1; EZH2b; KMT6; KMT6A; WVS; WVS2; histone-lysine N-methyltransferase EZH2
Applications IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2 (NP_001190176.1).
Reactivity Human
Gene ID 2146
Calculated MW 79kDa/81kDa/84kDa/85kDa/86kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Sensitivity WB,1:500 - 1:2000|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents