ETV4 Polyclonal AntibodyETV4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ETV4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13860-200ul 200ul
£332.50
A13860-100ul 100ul
£192.50
A13860-50ul 50ul
£113.75
A13860-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13860
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ETV4; E1A-F; E1AF; PEA3; PEAS3; ETS variant 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1).
Reactivity Rat
Gene ID 2118
Calculated MW 23kDa/49kDa/53kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents