ETV1 Polyclonal AntibodyETV1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ETV1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13303-200ul 200ul
£332.50
A13303-100ul 100ul
£192.50
A13303-50ul 50ul
£113.75
A13303-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13303
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ETV1; ER81; ETS variant 1
Applications IF, IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-300 of human ETV1 (NP_004947.2).
Reactivity Human, Mouse, Rat
Gene ID 2115
Calculated MW 43kDa/48kDa/50kDa/52kDa/53kDa/55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
Sensitivity IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents