ETS1 Polyclonal AntibodyETS1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ETS1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13302-200ul 200ul
£332.50
A13302-100ul 100ul
£192.50
A13302-50ul 50ul
£113.75
A13302-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13302
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ETS1; ETS-1; EWSR2; c-ets-1; p54; protein C-ets-1
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ETS1 (NP_005229.1).
Reactivity Human, Mouse
Gene ID 2113
Calculated MW 25kDa/30kDa/40kDa/50kDa/55kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents