ETFB Polyclonal AntibodyETFB Polyclonal Antibody
Move your mouse over image or click to enlarge

ETFB Polyclonal Antibody

Cat# Size Price Qty Buy
A16043-20ul 20ul
£77.00
A16043-50ul 50ul
£113.75
A16043-100ul 100ul
£192.50
A16043-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16043
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ETFB; FP585; MADD; electron transfer flavoprotein subunit beta
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1).
Reactivity Human, Mouse, Rat
Gene ID 2109
Calculated MW 27kDa/37kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents