ESRRG Polyclonal AntibodyESRRG Polyclonal Antibody
Move your mouse over image or click to enlarge

ESRRG Polyclonal Antibody

Cat# Size Price Qty Buy
A3853-200ul 200ul
£332.50
A3853-100ul 100ul
£192.50
A3853-50ul 50ul
£113.75
A3853-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3853
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ESRRG; ERR3; ERRgamma; NR3B3; estrogen-related receptor gamma
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2).
Reactivity Human, Mouse, Rat
Gene ID 2104
Calculated MW 44kDa/48kDa/49kDa/51kDa/52kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents