ERP44 Polyclonal AntibodyERP44 Polyclonal Antibody
Move your mouse over image or click to enlarge

ERP44 Polyclonal Antibody

Cat# Size Price Qty Buy
A4526-200ul 200ul
£332.50
A4526-100ul 100ul
£192.50
A4526-50ul 50ul
£113.75
A4526-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4526
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ERP44; PDIA10; TXNDC4; endoplasmic reticulum protein 44
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 57-406 of human ERP44 (NP_055866.1).
Reactivity Human, Mouse, Rat
Gene ID 23071
Calculated MW 46kDa
Observed MW 40-48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents