ERCC2 Polyclonal AntibodyERCC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ERCC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14563-200ul 200ul
£332.50
A14563-100ul 100ul
£192.50
A14563-50ul 50ul
£113.75
A14563-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14563
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ERCC2; COFS2; EM9; TFIIH; TTD; TTD1; XPD; ERCC excision repair 2, TFIIH core complex helicase subunit
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ERCC2 (NP_001124339.1).
Reactivity Human, Mouse, Rat
Gene ID 2068
Calculated MW 46kDa/86kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents