ENPP4 Polyclonal AntibodyENPP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ENPP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A4516-200ul 200ul
£332.50
A4516-100ul 100ul
£192.50
A4516-50ul 50ul
£113.75
A4516-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4516
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ENPP4; NPP4; bis(5'-adenosyl)-triphosphatase ENPP4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-230 of human ENPP4 (NP_055751.1).
Reactivity Human, Mouse
Gene ID 22875
Calculated MW 51kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents