ENPP2 Polyclonal AntibodyENPP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ENPP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16021-50ul 50ul
£113.75
A16021-100ul 100ul
£192.50
A16021-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16021
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ENPP2; ATX; ATX-X; AUTOTAXIN; LysoPLD; NPP2; PD-IALPHA; PDNP2; ectonucleotide pyrophosphatase/phosphodiesterase 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 564-863 of human ENPP2 (NP_001035181.1).
Reactivity Human
Gene ID 5168
Calculated MW 98kDa/101kDa/105kDa
Observed MW 130kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLHTYESEI
Sensitivity WB,1:500 - 1:2000
Storage Store at 4℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents