EMR2 Polyclonal AntibodyEMR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EMR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14278-200ul 200ul
£332.50
A14278-100ul 100ul
£192.50
A14278-50ul 50ul
£113.75
A14278-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14278
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ADGRE2; CD312; EMR2; VBU; adhesion G protein-coupled receptor E2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-500 of human EMR2 (NP_038475.2).
Reactivity Human, Mouse
Gene ID 30817
Calculated MW 74kDa/80kDa/84kDa/85kDa/89kDa/90kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence TIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents