EML2 Polyclonal AntibodyEML2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EML2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4581-200ul 200ul
£332.50
A4581-100ul 100ul
£192.50
A4581-50ul 50ul
£113.75
A4581-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4581
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EML2; ELP70; EMAP-2; EMAP2; echinoderm microtubule-associated protein-like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-415 of human EML2 (NP_036287.1).
Reactivity Human, Mouse
Gene ID 24139
Calculated MW 70kDa/86kDa/92kDa
Observed MW 71kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents